Description
Size
10 ug
Catalog no.:
CJ09-10
Just click and buy
Quick buy process
We invite you to purchase this product. Our professional team will fulfill your order as soon as possible. Our experienced employees will take care of your order very quickly.
All details
Peptide sequence
KAVFKNGVSQRTFREIKEEIANYEDVAKAIINLAVYGKYQNRSYERLGLLVDTVGPRLSGSKNLEKAIQIMYQNLQQDGLENVHLEQVRIPHWERGEESAVMLEPRIHKMAILGLGSSIGTPPGGITAEVLVVASFDELQRRASEARGKIIVYNQPYTGYEKTVQYRVQGAVEAAKVGAVASLIQSVASFSIYSPHTGIQKYQDGVPKIPTACITVEDAEMMSRMASRGNKIVIHLEMGAKTYPDTDSFNTVAEITGSMYPEEVVLVSGHLDSWDVGQGALDDGGGAFISWEALSLVKDLGLRPKRTLRLVLWTAEEQGGIGASQYYELHKANISKYSLVMEADSGTFLPTGLQFTGSDKARAIMKEVMNLLQPLNVTKVFSNGEGTDINFWIQAGVPGASLRDDLYKYFFFHHSHGDTMTVMDPKQMNVAAAVWAVVAYVVADMDEMLPRSVDHHHHHH
Test
Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
Reconstitution conditions
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Description
Recombinant Mouse Plasma glutamate carboxypeptidase is produced by our Mammalian expression system and the target gene encoding Lys19-Ser470 is expressed with a 6His tag at the C-terminus.
Storage conditions
Store at below -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Package form
Supplied as a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Endotoxin level
Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Protein purity
Greater than 95% as determined by reducing SDS-PAGE.
Source
Recombinants or rec. proteins
Shipping condition
Dry Ice/ice packs
Latin name
Mus musculus
Group
recombinants
Origin
Human cells
Estimated molecular weight
50,9 kDa
UniProt number
Q9WVJ3
Species reactivity
Mouse